DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt8

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001100962.1 Gene:B3gnt8 / 308440 RGDID:1305374 Length:389 Species:Rattus norvegicus


Alignment Length:261 Identity:70/261 - (26%)
Similarity:120/261 - (45%) Gaps:14/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 CPQKGLSTQLLVLITSSLRHSAARMSIRQTWMH--YGSRRDVGMAFVLGKGKNKSVKKAIDQEDF 227
            |..|.: ..||:.:.|...|.|||.::|:||..  .|:|....:...||.| ...:...:..|..
  Rat   134 CSDKDV-PYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPLGMG-GPDLTSLVTWESR 196

  Fly   228 MYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKAN--R 290
            .|.||:...|:|...|.|||.:.||.|...||||..:||:..|:.|:::|.||..:..|...  |
  Rat   197 RYGDLLLWDFLDVPYNRTLKDLLLLTWLSHHCPKVSFVLQVQDNAFVHIPALLEHLQALPPTWAR 261

  Fly   291 TIY-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLE 354
            ::| |......||:|.....:::... :.:..:|.:.:|..|:::|.:...|...:...|....:
  Rat   262 SLYLGEVFTQAKPLRKPGGPFYVPKT-FFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFD 325

  Fly   355 DVFTTGIVAESLNIR-RVN---VREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNMLLDDTIK 415
            ||: ||....:|.:. |.:   :......||: :.|.:|..:.:|.|...:...||..|....::
  Rat   326 DVY-TGFCFRALGLAPRAHPGFLTAWPAERTR-DPCAVRGLLLVHPVSPQDTIWLWRHLWVPELR 388

  Fly   416 C 416
            |
  Rat   389 C 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 54/196 (28%)
B3gnt8NP_001100962.1 Galactosyl_T 154..341 CDD:419759 53/189 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.