DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt6

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001099681.1 Gene:B3gnt6 / 292325 RGDID:1310926 Length:392 Species:Rattus norvegicus


Alignment Length:265 Identity:65/265 - (24%)
Similarity:117/265 - (44%) Gaps:22/265 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRR-----DVGMAFVLGKGKNKSVKKAIDQEDFM----- 228
            ||:.:.||..|...|..||:||   |..|     .|...|::|....:...:.....|.:     
  Rat   114 LLLAVKSSPAHYERRELIRRTW---GQERSYSGQQVRRLFLVGTSSPEEAAREPQLADLLSLEAR 175

  Fly   229 -YQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTI 292
             :.|:::..|.|::.|||||.:.||:|.:.|||...::|..|||:|::...:|..:......|.:
  Rat   176 EHGDVLQWDFKDTFLNLTLKHLHLLDWTEEHCPGMSFLLSCDDDVFVHTANVLRFLEVQSPERHL 240

  Fly   293 Y-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDV 356
            : |:......|||..||||.:....:....:|.:.:|..:|::......|...|.:.....::|.
  Rat   241 FTGQLMAGSVPIRESWSKYFVPRQLFPGTAYPVYCSGGGFLMSRRTAQDLRRASHHVPLFPIDDA 305

  Fly   357 F------TTGIV-AESLNIRRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNMLLDDTI 414
            :      ..|:. :....||...|:.....|:.|:.|..|:.:.:|.....|...:|..|.|..:
  Rat   306 YMGMCLQQAGLAPSNHEGIRPFGVQLPGTKRSSFDPCMYRELLLVHRFAPYEMLLMWKALHDPAL 370

  Fly   415 KCDNQ 419
            :|.::
  Rat   371 QCSHR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 49/206 (24%)
B3gnt6NP_001099681.1 Galactosyl_T 126..320 CDD:304462 47/196 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm9010
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.