DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt9

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_008770778.1 Gene:B3gnt9 / 291958 RGDID:1310170 Length:398 Species:Rattus norvegicus


Alignment Length:294 Identity:80/294 - (27%)
Similarity:126/294 - (42%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 RMPLVKTIYKPGHLDSEIDMERICPQKGL---STQLLVLITSSLRHSAARMSIRQTWMHYGSRRD 203
            |.||:            |:..|.|...|.   |..||:.:.|.......|.::||||...|..:.
  Rat    96 RFPLL------------INQPRKCHSDGASGGSLDLLIAVKSVAADFERREAVRQTWGAEGRVQG 148

  Fly   204 --VGMAFVL---------GKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADL 257
              |...|:|         |.|.....:..::.|...|.|::...|.|::.|||||.|..|.||..
  Rat   149 ALVRRVFLLGVPKGAGSGGAGTRTHWRALLEAESRAYADILLWAFEDTFFNLTLKEIHFLSWASA 213

  Fly   258 HCPKAKYVLKTDDDMFINVPKLLTLISTL-KANRTIYGRRAENWKPIRNRWSKYHISNAQYGKPT 321
            .||...:|.|.|.|:|::|..||..:... .|...:.|......:|||.|.|||.|..|.||.|.
  Rat   214 FCPDVHFVFKGDADVFVHVRNLLQFLEPRDPAQDLLAGDVIVQARPIRARASKYFIPQAVYGLPV 278

  Fly   322 FPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNI--------RRVNVREMA- 377
            :|.:..|..::|:|..:|.|...........::||| .|:..:.|.:        |...:.:.: 
  Rat   279 YPAYAGGGGFVLSGATLHRLAHACTQVELFPIDDVF-LGMCLQRLRLTPEPHPAFRTFGISQPSA 342

  Fly   378 --NTRTKFETCHIRDKITIHMVRNNEQFTLWNML 409
              :.|| |:.|..|:.:.:|.:...:.:.:|.:|
  Rat   343 APHLRT-FDPCFYRELVVVHGLSAADIWLMWRLL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 61/207 (29%)
B3gnt9XP_008770778.1 Galactosyl_T 131..330 CDD:304462 60/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.