DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3galnt2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001138323.1 Gene:B3galnt2 / 291212 RGDID:1306946 Length:504 Species:Rattus norvegicus


Alignment Length:152 Identity:39/152 - (25%)
Similarity:69/152 - (45%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 IDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLIS-- 284
            :.:|..:|.|::....:|:|.|:..|.::...|. :.......:||||||.:|::..:...|:  
  Rat   312 LQKESSIYDDIVFVDVVDTYRNVPAKLLNFYRWT-VESTSFSLLLKTDDDCYIDLEAVFNRIAQK 375

  Fly   285 TLKANRTIYGRRAENWKPIR-NRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNT 348
            .|......:|....||...| .:|.:     .:|..|.:|.|..|..|:::.|||..|...|...
  Rat   376 NLDGPNFWWGNFRLNWAVDRTGKWQE-----LEYPSPAYPAFACGSGYVISKDIVDWLAGNSGRL 435

  Fly   349 AFLKLEDVFTTGIVAESLNIRR 370
            ...:.||| :.||...::..:|
  Rat   436 KTYQGEDV-SMGIWMAAIGPKR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 39/152 (26%)
B3galnt2NP_001138323.1 Galactosyl_T 309..459 CDD:304462 39/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.