DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt3

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001099538.1 Gene:B3gnt3 / 290638 RGDID:1305151 Length:378 Species:Rattus norvegicus


Alignment Length:283 Identity:72/283 - (25%)
Similarity:120/283 - (42%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 CPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRDVGMA----FVLGKGKN----KSVKKA 221
            |.|...   ||:.|.||..:...|..:|.||..  .||..|.:    |::|..::    :...:.
  Rat   100 CAQPAF---LLLAIKSSPANYGRRQVLRTTWAR--ERRVRGASLRRLFLVGSDRDPQQARKFNRL 159

  Fly   222 IDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTL 286
            ::.|...|.|:::..|.||:.|||||.:..|||...||..|.:||..|||:|.:...::|.:...
  Rat   160 LELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGR 224

  Fly   287 KANRTIY-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAF 350
            ..::.:: |...:|..|||..||||.|......:..:|.:..|..:||:...:.||:..:.....
  Rat   225 DPDQHLFVGHLIQNVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARVLPI 289

  Fly   351 LKLEDVF-------------------TTGIVAESLNIRRVNVREMANTRTKFETCHIRDKITIHM 396
            ..::|||                   |.|::..|..:            :.|:.|..||.:.:|.
  Rat   290 FPIDDVFLGMCLQQQGLAPGAHSGVRTAGVLPPSPRV------------SSFDPCFYRDLLLVHR 342

  Fly   397 VRNNEQFTLWNMLLDDTIKCDNQ 419
            ....|...:|:.|....:.|..|
  Rat   343 FLPFEMLLMWDALSRPQLACGRQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 55/215 (26%)
B3gnt3NP_001099538.1 Galactosyl_T 119..308 CDD:419759 52/190 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9010
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.