DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3galt5

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001099357.1 Gene:B3galt5 / 288161 RGDID:1306727 Length:308 Species:Rattus norvegicus


Alignment Length:304 Identity:98/304 - (32%)
Similarity:152/304 - (50%) Gaps:37/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ILAKKSVVLY-SIDT--EVPVRMPLVKTIYKPGHLD----SEIDMERICPQKGLSTQLLVLITSS 181
            :|...::.|| |:::  |:|.       ::|..|..    .|||    |.||  ...|::|:|||
  Rat    13 VLTMGALCLYFSMESFQELPF-------VFKKSHGKFLQLPEID----CKQK--PPFLVLLVTSS 64

  Fly   182 LRHSAARMSIRQTWMHYGS--RRDVGMAFVLGKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNL 244
            .:..||||:||:||....|  .:.|...|:||...:.....|...|...::|:|:..|.|:|.||
  Rat    65 HKQLAARMAIRKTWGRETSVQGQPVRTFFLLGSSDSTEDMDATALESEQHRDIIQKDFKDAYFNL 129

  Fly   245 TLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRT---IYGRRAENWKPIRNR 306
            ||||:..:||....||:..||:|||.|||:||..|..|:  ||.|:|   ..|....:..|||.:
  Rat   130 TLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELL--LKKNKTTRFFTGYIKPHDFPIRQK 192

  Fly   307 WSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRV 371
            ::|:.:|..:|....:|.|.:|..|:.:.|:...:|..|.:..|:|||||| .|:....|.||  
  Rat   193 FNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVF-VGLCLAKLKIR-- 254

  Fly   372 NVREMANTRT------KFETCHIRDKITIHMVRNNEQFTLWNML 409
             ..|:...:|      :|..|..:..:..|.::..:..|.|..|
  Rat   255 -PEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQAL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 71/192 (37%)
B3galt5NP_001099357.1 Galactosyl_T 69..259 CDD:304462 72/195 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5327
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13230
Inparanoid 1 1.050 142 1.000 Inparanoid score I4385
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm9010
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.