DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3galt2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_064409.3 Gene:B3galt2 / 26878 MGIID:1349461 Length:422 Species:Mus musculus


Alignment Length:271 Identity:84/271 - (30%)
Similarity:129/271 - (47%) Gaps:23/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRR-----DVGMAFVLGKG 213
            |....|:....|.:|  |..|::||.:......||.:|||||   |:..     .:...|:||..
Mouse   135 HFKYIINEPEKCQEK--SPFLILLIAAEPGQIEARRAIRQTW---GNETLAPGIQIIRVFLLGIS 194

  Fly   214 --KNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINV 276
              .|..::.||.:|...|.|:|:..::|:|.|||:||:..:.|...:||...||:|||.|||:|.
Mouse   195 IKLNGYLQHAIQEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNT 259

  Fly   277 PKLLTLISTLKAN---RTIY--GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGD 336
            ..|:..:  ||.:   |..|  |.....:.|.||:.||:::....|....:|.|.:|..|:.:||
Mouse   260 EYLIHKL--LKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGD 322

  Fly   337 IVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRV---NVREMANTRTKFETCHIRDKITIHMVR 398
            :...::..||....|.||||: .||....|.:..|   |.....:.|..:.:|.....||.|..:
Mouse   323 LAEKIFKVSLGIRRLHLEDVY-VGICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQ 386

  Fly   399 NNEQFTLWNML 409
            .:|....||.|
Mouse   387 PSELIKYWNHL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 67/202 (33%)
B3galt2NP_064409.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..110
Galactosyl_T 165..359 CDD:250845 66/199 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5437
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4452
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.