DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and pvg3

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_595999.1 Gene:pvg3 / 2540827 PomBaseID:SPBC1921.06c Length:378 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:62/292 - (21%)
Similarity:105/292 - (35%) Gaps:87/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QLLVLITSSLRHSAARMSIRQTWMHY----GSRRDVGMAFVLGKGKNKSVKKAIDQEDFMYQDL- 232
            :|.:.|.|..::...|..:|..:..|    .....|.:.|:||..:|:.....|.:|...|.|| 
pombe    65 KLYLGIFSQAKNVDRRNFLRTDYNEYIKEFAVNDTVDVRFILGLPENEQELATIREEQRTYGDLA 129

  Fly   233 -------------------------------------------IRGHFIDSYNNLTLKTISL--- 251
                                                       ..|.||  ||. ::||..|   
pombe   130 VLPIPENVDAGKSIVYFQTFLEGYQPFPLFSELADNLIMPSTQFHGSFI--YNQ-SIKTYELPGM 191

  Fly   252 LEWADLHCPKAKY--VLKTDDDMFINVPKLLTLIST-LKANRTIYGR---RAENWKPIRNRWSKY 310
            .|:.||..||..|  ::|.|||.|:|:|:|..::.. :..:|..:||   |.|....:|:     
pombe   192 KEFQDLGEPKHDYDFIVKADDDSFLNLPRLFEMLKEHVGKSRFYFGRDCTRRELPTAVRD----- 251

  Fly   311 HISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVRE 375
                       |||. .|..|:::.|:  |..|.......:..||..|...:..|.|::.....:
pombe   252 -----------FPYM-CGFFYIVSPDM--AYEVAKRRNIIIPFEDAQTGYSIYLSGNVKNAEFSK 302

  Fly   376 -------MANTRTKFETCHIR-DKITIHMVRN 399
                   :.|....:...::| |.|.:|.:::
pombe   303 CTLYDLILPNEGFNYRQSYLRIDAIAVHKLKS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 54/244 (22%)
pvg3NP_595999.1 Galactosyl_T 103..282 CDD:304462 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.