DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt4

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_011246501.1 Gene:B3gnt4 / 231727 MGIID:2680208 Length:410 Species:Mus musculus


Alignment Length:271 Identity:67/271 - (24%)
Similarity:120/271 - (44%) Gaps:44/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 TQLLVLITSSLRHSAARMSIRQTWMHYGS---RRDVGMAFVLGKGKNKSVKKAIDQEDFMYQDLI 233
            |.||::|.|...|...|.:||.||...||   .|.:.:.|:||........:.:..|.:.:.|::
Mouse   152 TFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGRQLKLVFLLGVAGPVPPAQLLVYESWQFDDIL 216

  Fly   234 RGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTIYGRRAE 298
            :..|.:.:.|||||.:.:..|....|.:|.::||.|||:||:||.:|..:              |
Mouse   217 QWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFL--------------E 267

  Fly   299 NW---------------KPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNT 348
            .|               :|.||...||.|..:.|....:|.:..|..|:::...|..|::.....
Mouse   268 GWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEA 332

  Fly   349 AFLKLEDVFTTGIVAESLNIRRVN--------VREMANTRTKFETCHIRDKITIHMVRNNEQFTL 405
            ....::||| .|:....|.:..::        :::..|.|   :.|..:..:.:|.:...|.:|:
Mouse   333 ELFPIDDVF-VGMCLRKLGVTPIHHAGFKTFGIQQPLNPR---DPCLYKGLLLVHRLSPLEMWTM 393

  Fly   406 WNMLLDDTIKC 416
            |.::.|:.:||
Mouse   394 WALVTDERLKC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 51/213 (24%)
B3gnt4XP_011246501.1 Galactosyl_T 166..355 CDD:389837 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.