DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3GNT6

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_619651.3 Gene:B3GNT6 / 192134 HGNCID:24141 Length:384 Species:Homo sapiens


Alignment Length:267 Identity:70/267 - (26%)
Similarity:124/267 - (46%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GLSTQLLVLITSSLRHSAARMSIRQTW---MHYGSRRDVGMAFVLG------KGKNKSVKKAIDQ 224
            |....||:.:.|:..|...|..||:||   ..||. |.|...|:||      :.:.:.:.:.:..
Human   114 GRGVFLLLAVKSAPEHYERRELIRRTWGQERSYGG-RPVRRLFLLGTPGPEDEARAERLAELVAL 177

  Fly   225 EDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKAN 289
            |...:.|:::..|.|::.|||||.:.||:|....||.|:::|..|||:|::...::..:......
Human   178 EAREHGDVLQWAFADTFLNLTLKHLHLLDWLAARCPHARFLLSGDDDVFVHTANVVRFLQAQPPG 242

  Fly   290 RTIY-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKL 353
            |.:: |:..|...|||:.||||.:....:....:|.:.:|..:||:|....||...:.:|....:
Human   243 RHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYCSGGGFLLSGPTARALRAAARHTPLFPI 307

  Fly   354 EDVFTTGIVAESL--------NIRRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNMLL 410
            :|.: .|:..|..        .||...|:.....::.|:.|..|:.:.:|.....|...:|..|.
Human   308 DDAY-MGMCLERAGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAPYEMLLMWKALH 371

  Fly   411 DDTIKCD 417
            ...:.||
Human   372 SPALSCD 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 55/205 (27%)
B3GNT6NP_619651.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..68
Galactosyl_T 131..323 CDD:304462 53/193 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm8535
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.