DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and T15D6.5

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_493136.2 Gene:T15D6.5 / 188532 WormBaseID:WBGene00011780 Length:383 Species:Caenorhabditis elegans


Alignment Length:241 Identity:59/241 - (24%)
Similarity:119/241 - (49%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRRDV-----GMAFVLGK-GKNKSVKKAIDQEDFMYQDL 232
            :|:::.|.....:.|..:|:|||:..:.:.:     .:.|::|. ..::.:.||:.:|...:.|:
 Worm   128 ILMIVASRPGSVSRRKVLRKTWMNKANSKIIRNGRMQVLFLVGMVAGDRDLMKAVKKEAESFGDI 192

  Fly   233 IRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTL---KANRTIYG 294
            |..:..|:|:||..|.:|||.:........|.:.|.|||:.....:|..|:...   .::.:|||
 Worm   193 IVMNLEDTYDNLPFKVLSLLLYGTNKASDFKIIGKIDDDVIFFPDRLTPLLDENVIDSSSYSIYG 257

  Fly   295 RRAENWK-PIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFT 358
            ..:::.: .:||....:::....|....:|.:..||.||:|....:.:...|....|:.:||...
 Worm   258 YLSQDDELVVRNETKPWYVPETAYNCTKYPVYALGPFYLITNKAANLIVENSRFQNFMTVEDALI 322

  Fly   359 TGIVAESLNIRRVNVREMANTRTKFETCHIRDKITIHM-VRNNEQF 403
            .||:||.|.|:|.::..:  .|.:|:....:..::.|| .|::.||
 Worm   323 AGIIAEGLGIQRHSLPMV--FRYRFDNTDGKKILSWHMSKRSDRQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 50/197 (25%)
T15D6.5NP_493136.2 Galactosyl_T 140..338 CDD:250845 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I3710
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4848
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.