DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and E03H4.11

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001361857.1 Gene:E03H4.11 / 184024 WormBaseID:WBGene00008478 Length:359 Species:Caenorhabditis elegans


Alignment Length:239 Identity:63/239 - (26%)
Similarity:113/239 - (47%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 IYKPGHLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRDVGMA-----F 208
            :|.|       ::|....:|    .:|:::.|.....|.|..:|||||:......|...     |
 Worm    78 LYLP-------EIEEASQEK----DILMIVASRTDSYARRNIMRQTWMNKSDSEIVANGRMKPLF 131

  Fly   209 VLG--KGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDD 271
            ::|  .|..| :||.:.||..:|.|:|.....|:|..||.|::::|.:.....|:.:.:.|.|:|
 Worm   132 LVGLTPGDYK-MKKMVMQEAKLYGDIIVVDMNDTYEELTYKSLAILLYGVSKAPRYQMIGKIDED 195

  Fly   272 MFINVPKLLTLISTLKANRT---IYGRRAENWKPI-RNRWSKYHISNAQYGKPTFPYFTTGPAYL 332
            :.....||..|......:.|   .||.:.:....| |::..::::..:.|....||.:.:|..|:
 Worm   196 VIFFPDKLTALYEQGIIDATPLCAYGYKIQAGARIFRDKNDRWYVPESSYSCSKFPEYVSGMLYM 260

  Fly   333 LTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVREM 376
            :|.:....:...:....|:::||||.|||:||.|.|   :||.:
 Worm   261 VTWEAAQQIIKSTKYRDFIQVEDVFLTGILAEDLGI---SVRNL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 55/198 (28%)
E03H4.11NP_001361857.1 Galactosyl_T 104..302 CDD:250845 57/202 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157708
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4776
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.