DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and bus-2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001255233.1 Gene:bus-2 / 176977 WormBaseID:WBGene00044618 Length:329 Species:Caenorhabditis elegans


Alignment Length:266 Identity:69/266 - (25%)
Similarity:120/266 - (45%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRDVGMAFVLGKGKNKSVKKAIDQEDFMYQ 230
            |.:..:..:|||:|:.......|..:|::|.:|.|.. |.:.|::|...:|.: ..|.:|...:.
 Worm    59 PDELPAPNVLVLVTTIASEFEMRNQVRKSWANYTSNA-VRVKFLMGIPADKQL-PLIQKESQEFN 121

  Fly   231 DLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTD-DDMFI--NVPKLL------TLISTL 286
            |||.....:.|.:|..||:::|.:...:.|..|.::|.| |::.|  |..:|.      .::...
 Worm   122 DLIIADLDEGYYSLASKTMAMLIYKTRYYPDTKCLVKADVDNVLILRNYERLCEEAVAPLILGKC 186

  Fly   287 KANRTIYGRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTG---------DIVHALY 342
            ..:||:          :||. :|:.:....|.:|.:|.:.:...|:|.|         :.:.:.:
 Worm   187 DVSRTV----------LRNT-TKWAVPEFVYSEPVYPTYCSTGTYVLAGKTVPQSLIKEAMSSPF 240

  Fly   343 VQSLNTAFLKL-EDVFTTGIVAESLNIRRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLW 406
            ..|||  |.|| |||..|||:||...|:|.::    |..:.||       |.....||..:.|..
 Worm   241 ANSLN--FRKLSEDVIFTGILAEKAGIKRRHI----NGLSFFE-------IPEFFCRNGFKTTYS 292

  Fly   407 NMLLDD 412
            ..||.|
 Worm   293 THLLSD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 54/206 (26%)
bus-2NP_001255233.1 Galactosyl_T 81..269 CDD:304462 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.