DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3GALT6

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_542172.2 Gene:B3GALT6 / 126792 HGNCID:17978 Length:329 Species:Homo sapiens


Alignment Length:198 Identity:61/198 - (30%)
Similarity:92/198 - (46%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWM-HYGSRRDVGMAFVLG-KGKNKSVKKAIDQEDFMYQDLIRGH 236
            |.||:.|:.|.:..|..||.||: ..|:..||...|.:| .|.....::|:::|...:.||:...
Human    59 LAVLVASAPRAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLLLLP 123

  Fly   237 FI-DSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTIYGRRAENW 300
            .: |:|.|||.|.:::|.|.|.|. ..::|||.|||.|..:..||..:...:..|    ||...|
Human   124 ALRDAYENLTAKVLAMLAWLDEHV-AFEFVLKADDDSFARLDALLAELRAREPAR----RRRLYW 183

  Fly   301 ---------KPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKL--- 353
                     || ..||.:.......|..|    :..|..|:|:.|:||.|   .|:..:|:.   
Human   184 GFFSGRGRVKP-GGRWREAAWQLCDYYLP----YALGGGYVLSADLVHYL---RLSRDYLRAWHS 240

  Fly   354 EDV 356
            |||
Human   241 EDV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 56/186 (30%)
B3GALT6NP_542172.2 Galactosyl_T 71..260 CDD:304462 56/186 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.