DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt5

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001152879.1 Gene:B3gnt5 / 108105 MGIID:2137302 Length:376 Species:Mus musculus


Alignment Length:211 Identity:67/211 - (31%)
Similarity:118/211 - (55%) Gaps:21/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRR--------DVGMAFVLGKG---KNKSVKKAIDQEDF 227
            ||:.|.::..:...|.:||:||   |:..        ::.:.|.||..   |.|.::|.:..||.
Mouse    88 LLLFIKTAPENYGRRSAIRKTW---GNENYVQSQLNANIKILFALGTPGPLKGKELQKRLIGEDQ 149

  Fly   228 MYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLK--ANR 290
            :|:|:|:..||||::|||.|.:....||:..||.||:::..|||:||::|.|:..:..|:  ..|
Mouse   150 VYKDIIQQDFIDSFHNLTSKFLLQFSWANTFCPHAKFLMTADDDIFIHMPNLIEYLQGLEQIGVR 214

  Fly   291 TIY-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALY--VQSLNTAFLK 352
            ..: |.......|:|::.|||::....|..|.:|.:|.|.||:::.|:...:|  .|:||:: :.
Mouse   215 DFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYEASQTLNSS-MY 278

  Fly   353 LEDVFTTGIVAESLNI 368
            ::||| .|:.|..:.|
Mouse   279 IDDVF-MGLCANKVGI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 64/199 (32%)
B3gnt5NP_001152879.1 Galactosyl_T 101..297 CDD:419759 64/198 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5437
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm8765
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.