DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3GALT5

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_149362.2 Gene:B3GALT5 / 10317 HGNCID:920 Length:314 Species:Homo sapiens


Alignment Length:250 Identity:92/250 - (36%)
Similarity:134/250 - (53%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRR-----DVGMAFVLGKGKNKSVKKAIDQEDFMYQDLI 233
            |::|:|||.:..|.||:|||||   |..|     .:...|:||...:.:..|.:|||...:.|:|
Human    63 LVLLVTSSHKQLAERMAIRQTW---GKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDII 124

  Fly   234 RGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRT---IYGR 295
            :..|:|.|.||||||:..:||....||:|.:|:|||.||||||..|..|:  ||.|||   ..|.
Human   125 QKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELL--LKKNRTTRFFTGF 187

  Fly   296 RAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTG 360
            ...|..|||..:||:.:|.::|....:|.|.:|..|:.:||:...:|..|.:..::|||||| .|
Human   188 LKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVF-VG 251

  Fly   361 IVAESLNIRRVNVREMANTRT------KFETCHIRDKITIHMVRNNEQFTLWNML 409
            :..|.||||   :.|:.:..|      :|..|..|..:..|.::.......|..|
Human   252 LCLERLNIR---LEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQAL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 79/195 (41%)
B3GALT5NP_149362.2 Galactosyl_T 75..265 CDD:304462 80/198 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5304
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13230
Inparanoid 1 1.050 143 1.000 Inparanoid score I4461
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm8535
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.