DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt4

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_005167417.1 Gene:b3galt4 / 101886595 ZFINID:ZDB-GENE-081104-482 Length:372 Species:Danio rerio


Alignment Length:249 Identity:76/249 - (30%)
Similarity:117/249 - (46%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTW---MHYGSRRDVGMAFVLGKGKNKSVKKAIDQEDFMYQDLIRG 235
            |:.|:.::..:..||.:||.||   :|....| |...||:|:..:..:.|.:.:|.....|||:|
Zfish    95 LITLVATAPPNRKARQAIRDTWGGEVHVRGHR-VMTLFVVGQPTDPVIGKELIEESKERGDLIQG 158

  Fly   236 HFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLIS-TLKANRT----IY-G 294
            .|.|:|.||||||:|:|.||...||:|.||.|.|||:..|...||..:: :.|.:.:    :| |
Zfish   159 RFTDTYTNLTLKTLSILGWARRFCPQAHYVAKVDDDVMFNPNALLQYLNLSFKRDESELLELYLG 223

  Fly   295 RRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKL------ 353
            |......|.||..|::.:|...|.....|.:.:|.||:|:..   ||...||....:.|      
Zfish   224 RVHMQVAPDRNPASRHFMSETAYAGMVLPDYCSGTAYVLSRS---ALLKLSLAAVAINLPKPLPP 285

  Fly   354 EDVFTTGIVAESLNIRRVNVREMA-NTRTKFETCHIRDKITIHMVRNNEQFTLW 406
            |||| .||.|.:..|...:....: .....:..|..:..:::|..........|
Zfish   286 EDVF-VGICAHTAGINPTHSPFFSGGPAVPYSRCCYQTMVSVHHTTPANMLNYW 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 71/202 (35%)
b3galt4XP_005167417.1 Galactosyl_T 107..305 CDD:304462 71/202 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.