DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt5.2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_012813706.2 Gene:b3galt5.2 / 100494668 XenbaseID:XB-GENE-992036 Length:311 Species:Xenopus tropicalis


Alignment Length:288 Identity:96/288 - (33%)
Similarity:141/288 - (48%) Gaps:41/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KTIYKPG----------HLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSR 201
            |..|.|.          .|..::..||..|      .|::|:|::......|..|||||   |..
 Frog    32 KIFYSPSLRSATVRETFQLRPKVQCERNPP------FLVLLVTTNHSQKEERNVIRQTW---GKE 87

  Fly   202 RDVG-----MAFVLGKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPK 261
            |.:|     ..|:||.|.|..:::.:.:|...|.|:|:..|||||.|||||||..:||...|||:
 Frog    88 RLIGDKLVSTYFLLGAGTNPRLQEELIEESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQ 152

  Fly   262 AKYVLKTDDDMFINVPKLLTLISTLKANRT---IYGRRAENWKPIRNRWSKYHISNAQYGKPTFP 323
            ..:|:|||.|||:|...|:.|:  :|.|:|   ..|....:..|||:..||::||.|:|.:..:|
 Frog   153 TTFVMKTDTDMFVNPLYLVELL--VKKNQTTDLFTGSLRLHDAPIRDINSKWYISTAEYPQAKYP 215

  Fly   324 YFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVREMANTRT------- 381
            .|.:|..|:.:.|:...:...|....|.|||||: .|:..|.|.|...|:    :|.|       
 Frog   216 PFCSGTGYVFSVDVAQRIQNVSSTVPFFKLEDVY-VGMCLEKLEINLQNL----HTETTFYAYKK 275

  Fly   382 KFETCHIRDKITIHMVRNNEQFTLWNML 409
            .|..|:.|..:|.|.|:..|.:..|..|
 Frog   276 PFTVCNYRKLVTSHGVQPGEIYLFWEAL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 75/195 (38%)
b3galt5.2XP_012813706.2 Galactosyl_T 77..265 CDD:419759 75/197 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13230
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm9429
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.