DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt5.1

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002938778.1 Gene:b3galt5.1 / 100494507 XenbaseID:XB-GENE-992040 Length:314 Species:Xenopus tropicalis


Alignment Length:290 Identity:102/290 - (35%)
Similarity:141/290 - (48%) Gaps:45/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KTIYKPG----------HLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSR 201
            |.||.|.          .|..:|..||..|      .|::|:|::.....||..|||||   |..
 Frog    35 KRIYSPSLRSATVRETFQLRPKIQCERNPP------FLVLLVTTTHSQKEARNVIRQTW---GKE 90

  Fly   202 RDVG-----MAFVLGKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPK 261
            |.:|     ..|:||.|.|..::..:..|...|.|:|:..|||||.|||||||..:||...|||:
 Frog    91 RLIGDKLVSTYFLLGAGTNPRLQGELTGESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQ 155

  Fly   262 AKYVLKTDDDMFINVPKLLTLISTLKANRT---IYGRRAENWKPIRNRWSKYHISNAQYGKPTFP 323
            ..:|:|||.|||:|...|:.|:  :|.|:|   ..|....:..||||..|||:||..:|....:|
 Frog   156 TTFVMKTDTDMFVNPLYLVELL--VKKNQTTDVFTGSLRLHDAPIRNNHSKYYISTTEYPLAKYP 218

  Fly   324 YFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVREMANTRTK------ 382
            .|.:|..|:.:.|:...:...|....|.|||||| .|:..|.:||      .:.|..||      
 Frog   219 PFCSGTGYVFSVDVAQKIQNVSSTVPFFKLEDVF-VGMCLEKVNI------NLQNLHTKPTFHAY 276

  Fly   383 ---FETCHIRDKITIHMVRNNEQFTLWNML 409
               |..|:.|..:|.|.||..|.:..|::|
 Frog   277 KKPFTICNYRKLVTSHGVRPRELYLFWDVL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 77/195 (39%)
b3galt5.1XP_002938778.1 Galactosyl_T 78..268 CDD:389837 78/201 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13230
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.