DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt4

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002938731.1 Gene:b3galt4 / 100489366 XenbaseID:XB-GENE-919694 Length:346 Species:Xenopus tropicalis


Alignment Length:243 Identity:75/243 - (30%)
Similarity:124/243 - (51%) Gaps:34/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PVRMPLVKTIYKPGHLDSEIDMERICPQKGLS--TQLLVLITSSLRHSAARMSIRQTWMHYGSRR 202
            |.|.|...|.:||..:       .:.|.|..|  ..||:|::|:..|...|.:|||||   ||..
 Frog    52 PTRSPPSTTPFKPPAI-------LLSPPKACSPAPMLLILVSSAPFHHERRNAIRQTW---GSSS 106

  Fly   203 DVGMA----FVLGKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAK 263
            ::...    ||||..::.:.:.|:.:|..::.|:|:..|.|||.|||:||:..|.|....|..|:
 Frog   107 NLDSQAVTFFVLGVPQSHNDQAALLEEAKIHGDIIQAAFNDSYRNLTMKTLVGLSWMSQRCHGAR 171

  Fly   264 YVLKTDDDMFINVPKLLTLISTLKANRTIYGRRAE------NWK--PIRNRWSKYHISNAQYGKP 320
            ::||||||:|:|         |...:|.:.|:...      :||  |.|:..|:::.|...|.:.
 Frog   172 FLLKTDDDVFVN---------TFSLSRYLQGQHGPLYLGRVHWKVYPNRDPDSRHYTSTDIYPEK 227

  Fly   321 TFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNI 368
            .|..:.:|..|:|:.::|..|..|:..:..:.||||: .|::|.:..|
 Frog   228 YFSPYCSGTGYILSHEVVEWLLQQTGKSPIIPLEDVY-VGLLAWAAGI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 61/195 (31%)
b3galt4XP_002938731.1 Galactosyl_T 93..278 CDD:389837 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9429
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.