DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt9

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002935272.1 Gene:b3galt9 / 100487553 XenbaseID:XB-GENE-6044171 Length:372 Species:Xenopus tropicalis


Alignment Length:274 Identity:71/274 - (25%)
Similarity:130/274 - (47%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VRMPLVKTIYKPGHLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRD-- 203
            :.|.|:|......::..|   |.:|  .|....||::::||..:...|.:||:||.:..:.:|  
 Frog    60 LNMQLLKKNISESYVIRE---EGLC--SGRDVFLLMVVSSSPENKTRRDTIRRTWGNMTNYKDLV 119

  Fly   204 VGMAFVLGKGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKT 268
            |...|.||:..::..:..:..|..:::|::...|:|:|.|.|||.|:.:||....||.|:::||.
 Frog   120 VVRMFALGRPTSEETQAELLVESQVHKDMVEASFLDTYENRTLKVITSMEWIVTFCPNARFILKV 184

  Fly   269 DDDMFINVPKLLTLISTL----KANRTIY-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTG 328
            |.:.|:||..|:..:|.|    :.:..:| ||......|.|...|.:.:..:.|....:|.:.:|
 Frog   185 DQEAFVNVESLVDYLSYLLTLERRSEDVYIGRVIHQGVPDREPKSLHFVPTSSYPDAFYPDYCSG 249

  Fly   329 PAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVREMANTR-TKFETCHIRDKI 392
            .|.:::.|:...:|:.|.:...|...||| .|:.|....:..|:....:..: ..:..|..|...
 Frog   250 TALVISQDVARKVYLVSKDETTLLPPDVF-LGMCARKAGVVPVHSSRFSGPKHITYNRCCYRFIF 313

  Fly   393 TIHMVRNNEQFTLW 406
            :...|...|...||
 Frog   314 SSSSVGEEELSFLW 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 54/194 (28%)
b3galt9XP_002935272.1 Galactosyl_T 101..292 CDD:389837 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.