DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002932191.1 Gene:b3galt2 / 100487440 XenbaseID:XB-GENE-22172614 Length:421 Species:Xenopus tropicalis


Alignment Length:261 Identity:86/261 - (32%)
Similarity:130/261 - (49%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 CPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSR------RDVGMAFVLGKGKNKS--VKKA 221
            |.:|  :..|::||.:..|...||.:|||||   |:.      |.|.: |:||......  :::|
 Frog   145 CQEK--TPFLILLIAAEPRQIEARQAIRQTW---GNESLAPGFRTVRL-FLLGLHATADGLIQQA 203

  Fly   222 IDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTL 286
            |..|...|.|:|:..::|:|.|||:||:..:.|...:|||..||:|||.|||:|...|:..:  |
 Frog   204 IMDESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPKVLYVMKTDSDMFVNTEYLIHKL--L 266

  Fly   287 KAN---RTIY--GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSL 346
            |.:   ||.|  |.....:.|.||:.||:::....|....:|.|.:|..|:.:||:...::..||
 Frog   267 KPDLPPRTNYFTGYLMRGYAPNRNKDSKWYMPQDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSL 331

  Fly   347 NTAFLKLEDVFTTGIVAESLNIRRV---NVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNM 408
            :...|.||||: .||....|.|..|   |.....:.|..:.:|.....||.|..:..|....||.
 Frog   332 SIRRLHLEDVY-VGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPGELIKYWNH 395

  Fly   409 L 409
            |
 Frog   396 L 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 71/203 (35%)
b3galt2XP_002932191.1 Galactosyl_T 164..358 CDD:250845 70/200 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.