DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and TBPL1

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001240605.1 Gene:TBPL1 / 9519 HGNCID:11589 Length:186 Species:Homo sapiens


Alignment Length:181 Identity:71/181 - (39%)
Similarity:102/181 - (56%) Gaps:4/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DAQHEIRLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRG-VIMRMHSPRCTALIFRTGKVIC 107
            |...:|.:.|:|..|...|.|:|:.|.....|..|  ||..| |:|::..||.||.|:.:||:||
Human     6 DVALDILITNVVCVFRTRCHLNLRKIALEGANVIY--KRDVGKVLMKLRKPRITATIWSSGKIIC 68

  Fly   108 TGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPE 172
            |||.:|.||..|:|:.||.||||||.|.|.::|:.|::|..::.|.|||......:...:|||||
Human    69 TGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPE 133

  Fly   173 MFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            :.|.:.||:...|..|.||..|.:..|| .:.|.:...:|.|.|.:...||
Human   134 LHPAVCYRIKSLRATLQIFSTGSITVTG-PNVKAVATAVEQIYPFVFESRK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 70/176 (40%)
TBP_eukaryotes 50..221 CDD:239952 67/171 (39%)
TBPL1NP_001240605.1 TLF 9..180 CDD:239953 68/173 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62182
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.