DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and SPT15

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_011075.3 Gene:SPT15 / 856891 SGDID:S000000950 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:113/239 - (47%)
Similarity:153/239 - (64%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VADAER-----DRDNVAATSNA----------AANPHAALQPQQPVALVEPKDAQHEI------- 49
            :||.||     :.:.:....|.          ...|....|.::.:....|:..:...       
Yeast     1 MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVP 65

  Fly    50 RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEI 114
            .|||||||.::.|.||||.:....||:||:||||..||||:..|:.|||||.:||::.|||::|.
Yeast    66 TLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSED 130

  Fly   115 EADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIY 179
            ::.:.|||:|||:||:||..||.::|:||||.:.|::||||||.|...||.|||||||:||||||
Yeast   131 DSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIY 195

  Fly   180 RMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |||||:|||||||:||:|.||||.|::|....|||.|:|..|||
Yeast   196 RMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 105/182 (58%)
TBP_eukaryotes 50..221 CDD:239952 102/170 (60%)
SPT15NP_011075.3 PLN00062 64..239 CDD:177693 103/174 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62182
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.