DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and TBP1

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_187953.1 Gene:TBP1 / 820546 AraportID:AT3G13445 Length:200 Species:Arabidopsis thaliana


Alignment Length:173 Identity:103/173 - (59%)
Similarity:136/173 - (78%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIE 115
            |||||:|.:::|:||||||..:.||:||:||||..||||:..|:.|||||.:||::||||::|..
plant    25 LQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDF 89

  Fly   116 ADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYR 180
            :.:.:||:|||:||||||.||.::|:||||.:.|::||||||.|.:.|..|||||||:|||||||
plant    90 SKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYR 154

  Fly   181 MVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |..|:|||||||:||:|.||||.|.:.....|.|.|:|..|||
plant   155 MKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 103/173 (60%)
TBP_eukaryotes 50..221 CDD:239952 100/169 (59%)
TBP1NP_187953.1 PLN00062 22..200 CDD:177693 103/173 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62182
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.