DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Tbpl2

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001092831.1 Gene:Tbpl2 / 680050 RGDID:1596837 Length:344 Species:Rattus norvegicus


Alignment Length:227 Identity:110/227 - (48%)
Similarity:159/227 - (70%) Gaps:11/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADAERDRDNVAATSNAAANPHAALQPQQ---PVALVEPKDAQHEI--------RLQNIVATFSVN 61
            :::..|..:...:.:|.:|..::..|..   ||.|:......:.:        :|||:|:|.::.
  Rat   117 SNSSPDTQSCLCSHDADSNQLSSETPNSNALPVVLISSMTPMNPVTECSGIVPQLQNVVSTANLA 181

  Fly    62 CELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARI 126
            |:|||:.|....:|:||:||||..||||:..||.|||||.:|||:||||::|.|:.:.:||:||:
  Rat   182 CKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEDESRLAARKYARV 246

  Fly   127 LQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIF 191
            :|||||||:|..:|:||:||:.|::||||||.|...|.||||||||:||||||:||||::|||||
  Rat   247 VQKLGFPVRFFNFKIQNMVASCDVKFPIRLEILALTHRQFSSYEPELFPGLIYKMVKPQVVLLIF 311

  Fly   192 VNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            .:||||.||||.|.:|.:..|.:.|||.||:|
  Rat   312 ASGKVVLTGAKERSEIYEAFENMYPILESFKK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 103/183 (56%)
TBP_eukaryotes 50..221 CDD:239952 100/170 (59%)
Tbpl2NP_001092831.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..143 3/25 (12%)
PLN00062 168..344 CDD:177693 103/176 (59%)
TBP_eukaryotes 168..341 CDD:239952 100/172 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.