DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and tbp

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001016339.1 Gene:tbp / 549093 XenbaseID:XB-GENE-488470 Length:297 Species:Xenopus tropicalis


Alignment Length:196 Identity:113/196 - (57%)
Similarity:148/196 - (75%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LQPQQPVALVEPKDAQHEI--RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSP 93
            :.|..|:....|......|  :|||||:|.::.|:||||.|..|.||:||:||||..||||:..|
 Frog   101 MTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP 165

  Fly    94 RCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLEN 158
            |.|||||.:||::||||::|.::.:.:||:||::||||||.||:::|:||:|.:.|::||||||.
 Frog   166 RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEG 230

  Fly   159 LNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |...|.||||||||:||||||||:||||||||||:||||.||||.|.:|.:..|.|.|||..|||
 Frog   231 LVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 295

  Fly   224 T 224
            |
 Frog   296 T 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 108/176 (61%)
TBP_eukaryotes 50..221 CDD:239952 105/170 (62%)
tbpNP_001016339.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..116 3/14 (21%)
PLN00062 120..296 CDD:177693 107/175 (61%)
1. /evidence=ECO:0000255 123..199 43/75 (57%)
2. /evidence=ECO:0000255 213..290 51/76 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.