DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and tbpl2

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_005169867.1 Gene:tbpl2 / 407713 ZFINID:ZDB-GENE-040520-3 Length:313 Species:Danio rerio


Alignment Length:215 Identity:119/215 - (55%)
Similarity:155/215 - (72%) Gaps:16/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TSNAAAN---------PHAALQPQQPVALVEPKDAQHEI-RLQNIVATFSVNCELDLKAINSRTR 74
            |||:|.|         |...:.|..|||     ::...| :|||||:|.::.|.||||:|..:.|
Zfish   103 TSNSAQNTSQFNLPMTPMTPMTPMTPVA-----ESSGIIPQLQNIVSTVNLACPLDLKSIALQAR 162

  Fly    75 NSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGAR-NEIEADIGSRKFARILQKLGFPVKFME 138
            |:||:||||..||||:..||.|||||.:||::||||: :|.::.:.:||:||::||||||.||::
Zfish   163 NAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSSEEQSRLAARKYARVVQKLGFPAKFLD 227

  Fly   139 YKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKS 203
            :|:||:|.:.|:.||||||.|...|.||||||||:|||||||||||||||||||:||||.||||.
Zfish   228 FKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKE 292

  Fly   204 RKDIMDCLEAISPILLSFRK 223
            |.:|.:..|.|.|||..|||
Zfish   293 RSEIYEAFENIYPILKGFRK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 109/177 (62%)
TBP_eukaryotes 50..221 CDD:239952 105/171 (61%)
tbpl2XP_005169867.1 PLN00062 136..312 CDD:177693 107/175 (61%)
TBP_eukaryotes 136..310 CDD:239952 106/173 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.