DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and TBPL2

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_950248.2 Gene:TBPL2 / 387332 HGNCID:19841 Length:343 Species:Homo sapiens


Alignment Length:227 Identity:115/227 - (50%)
Similarity:157/227 - (69%) Gaps:24/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SNAAANPHAAL----------QPQQP------VALVEPKDAQHEI--------RLQNIVATFSVN 61
            |::.:|.|:.|          .|::|      :|.:.|......|        :|||||:|.::.
Human   116 SSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVNLA 180

  Fly    62 CELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARI 126
            |:||||.|....:|:||:||||..||||:..||.|||||.:||::||||::|.::.:.:||:||:
Human   181 CKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV 245

  Fly   127 LQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIF 191
            :||||||.:|:::|:||:|.:.|:|||||||.|...|.||||||||:||||||||||||||||||
Human   246 VQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIF 310

  Fly   192 VNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |:||||.||||.|.:|.:..|.|.|||..|:|
Human   311 VSGKVVLTGAKERSEIYEAFENIYPILKGFKK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 107/183 (58%)
TBP_eukaryotes 50..221 CDD:239952 104/170 (61%)
TBPL2NP_950248.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.