DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Tbp

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster


Alignment Length:204 Identity:114/204 - (55%)
Similarity:152/204 - (74%) Gaps:2/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NAAANPHAALQPQQPVALVEPKDAQHEI--RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFR 84
            :|.:|.|..:.|..|:....|..|...|  :|||||:|.::.|:||||.|....||:||:||||.
  Fly   148 DALSNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFA 212

  Fly    85 GVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVD 149
            .||||:..||.|||||.:||::||||::|.::.:.:||:|||:||||||.||:::|:||:|.:.|
  Fly   213 AVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCD 277

  Fly   150 LRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAI 214
            ::||||||.|...|..|||||||:|||||||||:|||||||||:||||.||||.|::|.|..:.|
  Fly   278 VKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKI 342

  Fly   215 SPILLSFRK 223
            .|||..|:|
  Fly   343 FPILKKFKK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 107/177 (60%)
TBP_eukaryotes 50..221 CDD:239952 104/170 (61%)
TbpNP_523805.1 PLN00062 176..351 CDD:177693 105/174 (60%)
TBP_eukaryotes 176..349 CDD:239952 104/172 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102547at33392
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.