DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and tbp

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_956390.1 Gene:tbp / 368882 ZFINID:ZDB-GENE-030616-563 Length:302 Species:Danio rerio


Alignment Length:214 Identity:118/214 - (55%)
Similarity:152/214 - (71%) Gaps:8/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATSNAAANP------HAALQPQQPVALVEPKDAQHEI--RLQNIVATFSVNCELDLKAINSRTRN 75
            |.|...|.|      ...|.|..|:....|......|  :|||||:|.::.|:||||.|..|.||
Zfish    88 AVSTTTALPGNTPLYTTPLTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARN 152

  Fly    76 SEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYK 140
            :||:||||..||||:..||.|||||.:||::||||::|.::.:.:||:||::||||||.||:::|
Zfish   153 AEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFK 217

  Fly   141 LQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRK 205
            :||:|.:.|::||||||.|...|.||||||||:||||||||:||||||||||:||||.||||.|.
Zfish   218 IQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRG 282

  Fly   206 DIMDCLEAISPILLSFRKT 224
            :|.:..|.|.|||..||||
Zfish   283 EIYEAFENIYPILKGFRKT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 108/176 (61%)
TBP_eukaryotes 50..221 CDD:239952 105/170 (62%)
tbpNP_956390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
PLN00062 125..301 CDD:177693 107/175 (61%)
TBP_eukaryotes 125..298 CDD:239952 105/172 (61%)
1. /evidence=ECO:0000255 128..204 43/75 (57%)
2. /evidence=ECO:0000255 218..295 51/76 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.