DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Trf5

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster


Alignment Length:230 Identity:42/230 - (18%)
Similarity:95/230 - (41%) Gaps:19/230 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVADAERDRDNVAATSNAAANPHAAL-----QPQQP-----VALVEPKDAQHEI-RLQNIV---- 55
            |::.:::|..:....:|.|:.....:     .|::|     :::.|......:| |..|::    
  Fly    38 KLSTSDQDPSDRQVLANKASEGAEEMSLPIVNPREPTLKDVLSIYENVSKLGDIQRYLNVIYKPF 102

  Fly    56 -ATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTG-ARNEIEADI 118
             .......:..|..::...:|:.:.|::...:.:..:||..:..|:..|.:.|.. .:|  .|..
  Fly   103 YCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIRIYPHGNIYCQAFCKN--SARY 165

  Fly   119 GSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVK 183
            |.....:.|:.||:..:....|...:.||..:.|.:.|...:..:...:.|:...:|.|:|:|:.
  Fly   166 GLANILKELRYLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLENPVVTRYDTSKYPFLVYKMMG 230

  Fly   184 PRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPIL 218
            ..:.:.||..|.|:...|.:.:.....:..|.|.|
  Fly   231 TTVEIAIFPTGYVIVLFATTMEITKLAIAHILPTL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 35/177 (20%)
TBP_eukaryotes 50..221 CDD:239952 34/175 (19%)
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 31/156 (20%)
TBP 191..267 CDD:278767 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.