DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Trf4

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster


Alignment Length:214 Identity:46/214 - (21%)
Similarity:76/214 - (35%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIRLQNIVATFSVNCELDLKAINSRT 73
            |.|...||||                 .:|.:|.|   .|:..:........||...:..:....
  Fly   101 DYENIFDNVA-----------------NLAEIEEK---LELHFRPFTCVMDFNCRFSMYELCLLL 145

  Fly    74 RNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFME 138
            ..|.:.|.....|::::..|.....|...||:..| |.|...|..|..|..||||.|.:.|..|.
  Fly   146 AESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIRILQDLDYKVDIMN 209

  Fly   139 YKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKS 203
            :....:.|:..:.|.|.|:.::..|....:......|.:.|......:...:|..|.|:...:.|
  Fly   210 FSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTS 274

  Fly   204 RKDIMDCLEAISPILLSFR 222
            ..:..:.:....|||...:
  Fly   275 HCETREAIANFLPILAKLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 36/174 (21%)
TBP_eukaryotes 50..221 CDD:239952 36/170 (21%)
Trf4NP_608699.1 TBP 128..200 CDD:278767 18/72 (25%)
PLN00062 131..294 CDD:177693 36/164 (22%)
TBP 213..291 CDD:278767 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.