DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Trf2

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster


Alignment Length:228 Identity:77/228 - (33%)
Similarity:128/228 - (56%) Gaps:13/228 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQFHFKVADAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHE--IRLQNIVATFSVNCE 63
            ||....:.|.:.::..||.....::|....:...||:|     |.:||  |.:.|:|.:|||.|.
  Fly  1240 MQSITVIDDDDEEKKEVAEDEEESSNNAKPIDLHQPIA-----DNEHELDIVINNVVCSFSVGCH 1299

  Fly    64 LDLKAINSRTRNSEYSPKRFRGVI-MRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARIL 127
            |.|:.|..:..|.||  :|..|:: |::..|..||.|:.:|::.||||.:|..|.:.:|::||.|
  Fly  1300 LKLREIALQGSNVEY--RRENGMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCL 1362

  Fly   128 QKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRM--VKPRIVLLI 190
            .|||||.:|:.:::.|::.|..:.:.|::.|.:..|.:.:|||||:.||:.|:|  ..|:..|.|
  Fly  1363 GKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKI 1427

  Fly   191 FVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |..|.|..|.| |...:...::.|.|::..|||
  Fly  1428 FSTGSVTVTAA-SVNHVESAIQHIYPLVFDFRK 1459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 65/178 (37%)
TBP_eukaryotes 50..221 CDD:239952 61/173 (35%)
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 62/175 (35%)
PLN00062 1285..1459 CDD:177693 63/176 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.