DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Tbpl2

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_951014.1 Gene:Tbpl2 / 227606 MGIID:2684058 Length:350 Species:Mus musculus


Alignment Length:258 Identity:118/258 - (45%)
Similarity:165/258 - (63%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVADAE----RDRDN-----------VAATSNAAANPHAAL--------QPQQ--------PVAL 39
            |:|..|    |||.:           :...||::.:|.:.|        ||..        ||||
Mouse    92 KLASEESCRTRDRQSQLQLPDEHGSELNLNSNSSPDPQSCLCFDDAHSNQPSPETPNSNALPVAL 156

  Fly    40 VEPKDAQHEI--------RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCT 96
            :......:.:        :|||:|:|.::.|:|||:.|....:|:||:||||..||||:..||.|
Mouse   157 IASMMPMNPVPGFSGIVPQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTT 221

  Fly    97 ALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNH 161
            ||||.:|||:||||::|.|:.:.:||:||::|||||||:|..:|:||:|.:.|::||||||.|..
Mouse   222 ALIFSSGKVVCTGAKSEEESRLAARKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILAL 286

  Fly   162 VHGQF-SSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            .|.|| ||||||:||||||:||||::|||||.:||||.||||.|.:|.:..|.:.|||.||:|
Mouse   287 THRQFSSSYEPELFPGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESFKK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 102/184 (55%)
TBP_eukaryotes 50..221 CDD:239952 99/171 (58%)
Tbpl2NP_951014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..150 12/57 (21%)
PLN00062 173..350 CDD:177693 102/177 (58%)
TBP_eukaryotes 173..347 CDD:239952 99/173 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.