Sequence 1: | NP_476939.1 | Gene: | Trf / 34102 | FlyBaseID: | FBgn0010287 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038712.3 | Gene: | Tbp / 21374 | MGIID: | 101838 | Length: | 316 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 113/196 - (57%) |
---|---|---|---|
Similarity: | 148/196 - (75%) | Gaps: | 2/196 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 LQPQQPVALVEPKDAQHEI--RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSP 93
Fly 94 RCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLEN 158
Fly 159 LNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
Fly 224 T 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Trf | NP_476939.1 | PLN00062 | 49..224 | CDD:177693 | 108/176 (61%) |
TBP_eukaryotes | 50..221 | CDD:239952 | 105/170 (62%) | ||
Tbp | NP_038712.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 104..135 | 3/14 (21%) | |||
PLN00062 | 139..315 | CDD:177693 | 107/175 (61%) | ||
TBP_eukaryotes | 139..312 | CDD:239952 | 105/172 (61%) | ||
Repetitive region | 142..218 | 43/75 (57%) | |||
Repetitive region | 232..309 | 51/76 (67%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1219067at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001202 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100597 | |
Panther | 1 | 1.100 | - | - | O | PTHR10126 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.820 |