DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Tbp

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_038712.3 Gene:Tbp / 21374 MGIID:101838 Length:316 Species:Mus musculus


Alignment Length:196 Identity:113/196 - (57%)
Similarity:148/196 - (75%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LQPQQPVALVEPKDAQHEI--RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSP 93
            :.|..|:....|......|  :|||||:|.::.|:||||.|..|.||:||:||||..||||:..|
Mouse   120 MTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP 184

  Fly    94 RCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLEN 158
            |.|||||.:||::||||::|.::.:.:||:||::||||||.||:::|:||:|.:.|::||||||.
Mouse   185 RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEG 249

  Fly   159 LNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |...|.||||||||:||||||||:||||||||||:||||.||||.|.:|.:..|.|.|||..|||
Mouse   250 LVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 314

  Fly   224 T 224
            |
Mouse   315 T 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 108/176 (61%)
TBP_eukaryotes 50..221 CDD:239952 105/170 (62%)
TbpNP_038712.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..135 3/14 (21%)
PLN00062 139..315 CDD:177693 107/175 (61%)
TBP_eukaryotes 139..312 CDD:239952 105/172 (61%)
Repetitive region 142..218 43/75 (57%)
Repetitive region 232..309 51/76 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.