DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and tbp-1

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001370645.1 Gene:tbp-1 / 176054 WormBaseID:WBGene00006542 Length:340 Species:Caenorhabditis elegans


Alignment Length:213 Identity:116/213 - (54%)
Similarity:153/213 - (71%) Gaps:9/213 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRDNVAATSNA-AANPHAALQPQQPVALVE-PKDAQHEIRLQNIVATFSVNCELDLKAINSRTRN 75
            |||  |.|..| |:|..|.:.|..|.:.:: |..|     |||||:|.::..:||||.|....||
 Worm   135 DRD--ALTHQAPASNIAATMVPATPASQLDIPMPA-----LQNIVSTVNLGVQLDLKKIALHARN 192

  Fly    76 SEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYK 140
            :||:||||..||||:..||.|||||.:||::||||::|..:.:.:||:|||:|||||..||.|:.
 Worm   193 AEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEASRLAARKYARIVQKLGFQAKFTEFM 257

  Fly   141 LQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRK 205
            :||:|.:.|:||||:||.|...|.|||:||||:||||||||||||:||||||:||||.||||:::
 Worm   258 VQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVKPRVVLLIFVSGKVVITGAKTKR 322

  Fly   206 DIMDCLEAISPILLSFRK 223
            ||.:....|.|||..|:|
 Worm   323 DIDEAFGQIYPILKGFKK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 103/175 (59%)
TBP_eukaryotes 50..221 CDD:239952 101/170 (59%)
tbp-1NP_001370645.1 TBP_eukaryotes 165..338 CDD:239952 102/177 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.