DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and tlf-1

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001122474.1 Gene:tlf-1 / 172676 WormBaseID:WBGene00006577 Length:508 Species:Caenorhabditis elegans


Alignment Length:212 Identity:66/212 - (31%)
Similarity:113/212 - (53%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NVAATSNAAANPHAALQPQQPVALVEPKDAQHEIRLQNIVATFSVNCELDLKAINSRTRNSEYSP 80
            :|.....:|||       ::|:    |.|...:|:::|:|..:::...:||:.:...|.|..|  
 Worm   246 DVPPEGTSAAN-------EEPM----PDDGDIDIQIRNVVCNYTLPLHIDLRKLAMNTHNVTY-- 297

  Fly    81 KRFRGVIMRM-HSPRCTALIFRTGKVICTGARNEIEADIGSRKFA----RILQKLGFPVKFMEYK 140
            :|.:||:|:. .||.|...::.:|||...|.|:|.:....:|..|    |::.|....|....|:
 Worm   298 EREKGVMMKQKRSPGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYR 362

  Fly   141 LQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRK 205
            :.|::||..|.|.|::|.:...:...|:||||:..||::|.|.|:..|.|...|.:..|||:|..
 Worm   363 VNNVLATCRLPFGIKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEA 427

  Fly   206 DIMDCLEAISPILLSFR 222
            |:::.|..|.||:|.||
 Worm   428 DVLEVLSKIYPIVLEFR 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 59/179 (33%)
TBP_eukaryotes 50..221 CDD:239952 56/175 (32%)
tlf-1NP_001122474.1 Med15 <3..>218 CDD:312941
KLF1_2_4_N <183..217 CDD:425360
TLF 266..442 CDD:239953 56/177 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.