DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf and Tbp

DIOPT Version :9

Sequence 1:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001004198.1 Gene:Tbp / 117526 RGDID:67398 Length:318 Species:Rattus norvegicus


Alignment Length:196 Identity:113/196 - (57%)
Similarity:148/196 - (75%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LQPQQPVALVEPKDAQHEI--RLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSP 93
            :.|..|:....|......|  :|||||:|.::.|:||||.|..|.||:||:||||..||||:..|
  Rat   122 MTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP 186

  Fly    94 RCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLEN 158
            |.|||||.:||::||||::|.::.:.:||:||::||||||.||:::|:||:|.:.|::||||||.
  Rat   187 RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEG 251

  Fly   159 LNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRK 223
            |...|.||||||||:||||||||:||||||||||:||||.||||.|.:|.:..|.|.|||..|||
  Rat   252 LVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 316

  Fly   224 T 224
            |
  Rat   317 T 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrfNP_476939.1 PLN00062 49..224 CDD:177693 108/176 (61%)
TBP_eukaryotes 50..221 CDD:239952 105/170 (62%)
TbpNP_001004198.1 PLN00062 141..317 CDD:177693 107/175 (61%)
TBP_eukaryotes 141..314 CDD:239952 105/172 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.