DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and RPL42A

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_014237.2 Gene:RPL42A / 855560 SGDID:S000005106 Length:106 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:74/106 - (69%)
Similarity:85/106 - (80%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFC--KKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTT 63
            ||||||.|:|:|  |.|:.|..|||||||..|....|||:|||||||.||||||||:|.||||||
Yeast     1 MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTT 65

  Fly    64 KKIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            ||:|||:||.:||.|.|..|||||||||||:||:|||.:||
Yeast    66 KKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKGQALQF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 56/84 (67%)
RPL42ANP_014237.2 PTZ00157 1..86 CDD:240296 56/84 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346841
Domainoid 1 1.000 120 1.000 Domainoid score I1260
eggNOG 1 0.900 - - E1_COG1631
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H776
Inparanoid 1 1.050 159 1.000 Inparanoid score I1067
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62194
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - otm46945
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - LDO PTHR10369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1139
SonicParanoid 1 1.000 - - X1275
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.