DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and AT3G23390

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_188981.1 Gene:AT3G23390 / 821920 AraportID:AT3G23390 Length:105 Species:Arabidopsis thaliana


Alignment Length:101 Identity:70/101 - (69%)
Similarity:83/101 - (82%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFC--KKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTT 63
            |||:||.:.|:|  |:||.|.|||||||||.|:...|||:|||||||.|:||||||:|.||||||
plant     1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTT 65

  Fly    64 KKIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKG 99
            ||||||::|..||:..|.|:|||||||:|||||.||
plant    66 KKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 56/84 (67%)
AT3G23390NP_188981.1 PTZ00157 1..86 CDD:240296 56/84 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1854
eggNOG 1 0.900 - - E1_COG1631
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H776
Inparanoid 1 1.050 156 1.000 Inparanoid score I1664
OMA 1 1.010 - - QHG62194
OrthoDB 1 1.010 - - D1392093at2759
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - oto3780
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - O PTHR10369
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.