DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and Rpl36al

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_079865.1 Gene:Rpl36al / 66483 MGIID:1913733 Length:106 Species:Mus musculus


Alignment Length:106 Identity:80/106 - (75%)
Similarity:90/106 - (84%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTKK 65
            ||||||.||||||||..|:.||||||||.|:...|||:|||||||.|:|||||||||||||||||
Mouse     1 MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKK 65

  Fly    66 IVLRMECTE--CKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            ||||:||.|  |:.::...:|||||||||||||||||:|||
Mouse    66 IVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 60/84 (71%)
Rpl36alNP_079865.1 PTZ00157 1..86 CDD:240296 60/84 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5827
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4118
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62194
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - otm44199
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - LDO PTHR10369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1139
SonicParanoid 1 1.000 - - X1275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.960

Return to query results.
Submit another query.