DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and RGD1566373

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_006256432.1 Gene:RGD1566373 / 365560 RGDID:1566373 Length:106 Species:Rattus norvegicus


Alignment Length:106 Identity:76/106 - (71%)
Similarity:86/106 - (81%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTKK 65
            ||||||.||||||||..|:.||||||||.|:...|||:|||||||..:||:|||||.|||||.||
  Rat     1 MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLSAQGKRRYDRKQSVYGGKTKPIFCKKAKTRKK 65

  Fly    66 IVLRMECTE--CKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            ||||:||.|  |..::...:|||||||||||||||||:|||
  Rat    66 IVLRLECVEPHCGSKRMLAIKRCKHFELGGDKKRKGQVIQF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 56/84 (67%)
RGD1566373XP_006256432.1 PTZ00157 1..86 CDD:240296 56/84 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5701
eggNOG 1 0.900 - - E1_COG1631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4036
OMA 1 1.010 - - QHG62194
OrthoDB 1 1.010 - - D1392093at2759
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - otm46291
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - O PTHR10369
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.