DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and RGD1564617

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_008757082.1 Gene:RGD1564617 / 308353 RGDID:1564617 Length:105 Species:Rattus norvegicus


Alignment Length:104 Identity:68/104 - (65%)
Similarity:82/104 - (78%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTKK 65
            ||||||.|:||||||..|:.|||||||..|:...|||::||||||.|.|||||.||.||||||:|
  Rat     1 MVNVPKTRQTFCKKCGKHQPHKVTQYKNGKDSLYAQGKQRYDRKQSGHGGQTKTIFCKKAKTTEK 65

  Fly    66 IVLRMECTE--CKYRKQTPLKRCKHFELGGDKKRKGQMI 102
            ||||:||.:  |:.::..|:||||.||||||||||..::
  Rat    66 IVLRLECVKPNCRSKRMLPIKRCKPFELGGDKKRKDPVL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 54/84 (64%)
RGD1564617XP_008757082.1 PTZ00157 1..86 CDD:240296 54/84 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5701
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4036
OMA 1 1.010 - - QHG62194
OrthoDB 1 1.010 - - D1392093at2759
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - otm46291
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - O PTHR10369
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1275
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.