DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and rpl42

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_594304.1 Gene:rpl42 / 2542789 PomBaseID:SPAC15E1.03 Length:106 Species:Schizosaccharomyces pombe


Alignment Length:106 Identity:72/106 - (67%)
Similarity:85/106 - (80%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFC--KKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTT 63
            |||:||.|:|:|  |.|:.|.:|:||||||..:.|.|||:|||||||.||||||||:|.||||.|
pombe     1 MVNIPKTRKTYCPGKNCRKHTVHRVTQYKKGPDSKLAQGKRRYDRKQSGFGGQTKPVFHKKAKVT 65

  Fly    64 KKIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            ||:|||:||..|||:.|..|||||||||||:||.||..|||
pombe    66 KKVVLRLECVSCKYKNQLVLKRCKHFELGGEKKTKGAAIQF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 54/84 (64%)
rpl42NP_594304.1 PTZ00157 1..86 CDD:240296 54/84 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 123 1.000 Domainoid score I1428
eggNOG 1 0.900 - - E1_COG1631
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H776
Inparanoid 1 1.050 160 1.000 Inparanoid score I1253
OMA 1 1.010 - - QHG62194
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - oto102005
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - LDO PTHR10369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1139
SonicParanoid 1 1.000 - - X1275
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.