DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and rpl36a

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001189439.1 Gene:rpl36a / 195819 ZFINID:ZDB-GENE-020423-1 Length:106 Species:Danio rerio


Alignment Length:106 Identity:80/106 - (75%)
Similarity:91/106 - (85%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTKK 65
            ||||||.|||:|||||.|:.||||||||.|:...|||:|||||||.|:|||||||||||||||||
Zfish     1 MVNVPKTRRTYCKKCKKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKK 65

  Fly    66 IVLRMECTE--CKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            ||||:||.|  |:.::...:|||||||||||||||||:|||
Zfish    66 IVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 60/84 (71%)
rpl36aNP_001189439.1 PTZ00157 1..86 CDD:240296 60/84 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..53 18/26 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5852
eggNOG 1 0.900 - - E1_COG1631
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H776
Inparanoid 1 1.050 171 1.000 Inparanoid score I4106
OMA 1 1.010 - - QHG62194
OrthoDB 1 1.010 - - D1392093at2759
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - oto40448
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - LDO PTHR10369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1139
SonicParanoid 1 1.000 - - X1275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.