DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and rpl-36.A

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_496375.1 Gene:rpl-36.A / 174695 WormBaseID:WBGene00004454 Length:105 Species:Caenorhabditis elegans


Alignment Length:105 Identity:86/105 - (81%)
Similarity:92/105 - (87%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFCK-KCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTK 64
            ||||||.|||||. ||:.|..||||||||.||.|.|||||||||||.||||||||||||||||||
 Worm     1 MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKKAKTTK 65

  Fly    65 KIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            ||||||||||||::||.|:||||||||||.||.:||:|||
 Worm    66 KIVLRMECTECKHKKQLPIKRCKHFELGGQKKSRGQVIQF 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 69/83 (83%)
rpl-36.ANP_496375.1 PTZ00157 1..85 CDD:240296 69/83 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160168006
Domainoid 1 1.000 140 1.000 Domainoid score I2966
eggNOG 1 0.900 - - E1_COG1631
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H776
Inparanoid 1 1.050 181 1.000 Inparanoid score I2661
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62194
OrthoDB 1 1.010 - - D1392093at2759
OrthoFinder 1 1.000 - - FOG0001921
OrthoInspector 1 1.000 - - oto19736
orthoMCL 1 0.900 - - OOG6_100788
Panther 1 1.100 - - LDO PTHR10369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1139
SonicParanoid 1 1.000 - - X1275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.