DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36A and LOC100910714

DIOPT Version :9

Sequence 1:NP_001285737.1 Gene:RpL36A / 34098 FlyBaseID:FBgn0031980 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_003751267.1 Gene:LOC100910714 / 100910714 RGDID:6496910 Length:120 Species:Rattus norvegicus


Alignment Length:106 Identity:74/106 - (69%)
Similarity:87/106 - (82%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTKK 65
            :|||||.|:||||||..|:.|||||||..|:...|||:|||||||.|:|||||||||||||:|||
  Rat    15 VVNVPKTRQTFCKKCGKHQPHKVTQYKMGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKSTKK 79

  Fly    66 IVLRMECTE--CKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104
            .|||:||.|  |:.::...:|||||||||||||||.|:|||
  Rat    80 NVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKCQVIQF 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36ANP_001285737.1 PTZ00157 1..84 CDD:240296 55/84 (65%)
LOC100910714XP_003751267.1 PTZ00157 16..100 CDD:240296 55/83 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.