DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCDC53 and washc3

DIOPT Version :9

Sequence 1:NP_609178.1 Gene:CCDC53 / 34097 FlyBaseID:FBgn0031979 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001016824.1 Gene:washc3 / 549578 XenbaseID:XB-GENE-988948 Length:199 Species:Xenopus tropicalis


Alignment Length:184 Identity:70/184 - (38%)
Similarity:99/184 - (53%) Gaps:10/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKFVEMERQLQKTEAALII 66
            |....:...:|.|::||:.|||.:||:|.|:|.:..|||.||..||.|...:..::|:.|..|.|
 Frog     4 DGLPIVGSGIDLTKVPPIQQKRTVAFLNQFVVHSVQFLNRFATVCEEKLSALSLRIQQIETTLNI 68

  Fly    67 LEAKLASIPTEHHVATEATEAPA--ISNQQRNEEASMVDTTEPPTTENPT-------EPELPPES 122
            |||||:|||....|..|....|.  |||.....:.........|.::|.:       :.|...|:
 Frog    69 LEAKLSSIPGLEDVKVETQHVPQSNISNGHLPSQPDAQSVIVSPQSDNNSISDGILQKEEAKSEN 133

  Fly   123 VGVRACEDQRYRKFFKMVQVGVPAPAVKQKMQSEGLEPRILDTPDLILADGQRE 176
            : ....:|.||.::.||||||||..|:|.||.||||.|.:|:|||..:.||:.|
 Frog   134 I-TTVSKDPRYARYLKMVQVGVPVMAIKNKMISEGLNPDLLETPDAPVPDGEAE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCDC53NP_609178.1 DUF2360 28..164 CDD:287161 53/144 (37%)
washc3NP_001016824.1 CCDC53 30..174 CDD:370834 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8087
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9364
Inparanoid 1 1.050 121 1.000 Inparanoid score I4616
OMA 1 1.010 - - QHG56897
OrthoDB 1 1.010 - - D1425330at2759
OrthoFinder 1 1.000 - - FOG0006422
OrthoInspector 1 1.000 - - oto104493
Panther 1 1.100 - - LDO PTHR13015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.