DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCDC53 and washc3

DIOPT Version :9

Sequence 1:NP_609178.1 Gene:CCDC53 / 34097 FlyBaseID:FBgn0031979 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_956467.1 Gene:washc3 / 393142 ZFINID:ZDB-GENE-040426-783 Length:200 Species:Danio rerio


Alignment Length:183 Identity:76/183 - (41%)
Similarity:102/183 - (55%) Gaps:12/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKFVEMERQLQKTEAALII 66
            |....:...||.|::|.:.|:||:||:|.|:|.|..|||.|:..||.|...:..::|:.|..|.|
Zfish     4 DGLPIVGSGVDLTKVPAIQQRRIVAFLNQFIVHTVRFLNRFSTVCEEKLSTVSLRIQQIETTLSI 68

  Fly    67 LEAKLASIPTEHHVATEATEAPAISNQQRNEEASMVDTTEPP------TTENPTEP--ELPPESV 123
            |||||||||....|..|...|||.:|   ...|.....|.||      |...|.||  |.|.|::
Zfish    69 LEAKLASIPGLEEVTVEGVRAPAETN---GPAADTSRATAPPAEASQQTQAAPQEPKTEAPAENI 130

  Fly   124 GVRACEDQRYRKFFKMVQVGVPAPAVKQKMQSEGLEPRILDTPDLILADGQRE 176
             :...:|.||.::.||||||||..|:|.||..|||:|.:|||||..:.|..::
Zfish   131 -MTVAKDPRYARYLKMVQVGVPVMAIKNKMMMEGLDPNLLDTPDAAVPDASKK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCDC53NP_609178.1 DUF2360 28..164 CDD:287161 60/143 (42%)
washc3NP_956467.1 DUF2360 30..170 CDD:287161 60/143 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..130 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..200 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581352
Domainoid 1 1.000 100 1.000 Domainoid score I6988
eggNOG 1 0.900 - - E1_KOG4496
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9364
Inparanoid 1 1.050 131 1.000 Inparanoid score I4617
OMA 1 1.010 - - QHG56897
OrthoDB 1 1.010 - - D1425330at2759
OrthoFinder 1 1.000 - - FOG0006422
OrthoInspector 1 1.000 - - oto41542
orthoMCL 1 0.900 - - OOG6_105305
Panther 1 1.100 - - LDO PTHR13015
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2443
SonicParanoid 1 1.000 - - X6219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.